PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00778.70
Common NameJMS09K11.9, LOC105638999
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 24908.6 Da    PI: 9.0065
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00778.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF916.1e-29959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien+snrqvt+skRr+gi+KKA+E+ vLCda+v+++if+s+gk++ey+s
  Jcr4S00778.70  9 KRIENTSNRQVTYSKRRAGIMKKAKEITVLCDAQVSLVIFASSGKMHEYCS 59
                   79***********************************************96 PP

2K-box821.4e-2771169199
          K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                    y+k+ gk+ ++ak+e+l++e++++kke++++q e+Rh++Ged+ sL++keL+++e++Le++l +iR+k++e+l+++ ++ +  e+e+++    L++
  Jcr4S00778.70  71 YHKHAGKRIWDAKHENLSNEIDRIKKENDSMQIELRHMKGEDIASLNHKELMHIEEALENGLASIRDKQMEYLKMMKKNEKILEEENKRLSFILQQ 166
                    789999********************************************************************9999999999999999999998 PP

          K-box  97 kle 99 
                    + +
  Jcr4S00778.70 167 QEM 169
                    865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.1E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.043161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-35296IPR002100Transcription factor, MADS-box
CDDcd002651.01E-38280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-1982161IPR002487Transcription factor, K-box
PROSITE profilePS5129715.67184170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGRGKIEIKR IENTSNRQVT YSKRRAGIMK KAKEITVLCD AQVSLVIFAS SGKMHEYCSP  60
STSLIEILDK YHKHAGKRIW DAKHENLSNE IDRIKKENDS MQIELRHMKG EDIASLNHKE  120
LMHIEEALEN GLASIRDKQM EYLKMMKKNE KILEEENKRL SFILQQQEMA IEENVRELEN  180
PYHQHRVRDY SSQMPFAFRV QPIQPNLQER M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D4e-18274171Myocyte-specific enhancer factor 2A
3mu6_C4e-18274171Myocyte-specific enhancer factor 2A
3mu6_B4e-18274171Myocyte-specific enhancer factor 2A
3mu6_A4e-18274171Myocyte-specific enhancer factor 2A
1egw_D5e-18274171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C5e-18274171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B5e-18274171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A5e-18274171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J6e-18274171Myocyte-specific enhancer factor 2A
3p57_I6e-18274171Myocyte-specific enhancer factor 2A
3p57_D6e-18274171Myocyte-specific enhancer factor 2A
3p57_C6e-18274171Myocyte-specific enhancer factor 2A
3p57_B6e-18274171Myocyte-specific enhancer factor 2A
3p57_A6e-18274171Myocyte-specific enhancer factor 2A
3kov_J6e-18274171Myocyte-specific enhancer factor 2A
3kov_I6e-18274171Myocyte-specific enhancer factor 2A
3kov_B6e-18274171Myocyte-specific enhancer factor 2A
3kov_A6e-18274171Myocyte-specific enhancer factor 2A
1tqe_S6e-18175173Myocyte-specific enhancer factor 2B
1tqe_R6e-18175173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0119671e-100AP011967.1 Jatropha curcas DNA, clone: JMS09K11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078322.11e-156PREDICTED: floral homeotic protein PMADS 2
SwissprotQ074741e-108MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLE6NU811e-156E6NU81_JATCU; JMS09K11.9 protein
STRINGPOPTR_0002s07920.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43553255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-88MIKC_MADS family protein